PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf11552g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 737aa    MW: 80364.7 Da    PI: 7.9602
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf11552g00015.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.43.3e-24157258199
                               EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT- CS
                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegD 78 
                               f+k+lt sd++++g +++p++ ae++       +  ++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD
  Niben101Scf11552g00015.1 157 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyrQ--QRPSQELVAKDLHGIEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGD 239
                               99****************************9743..345679******************************************* PP

                               EEEEEE-SSSEE..EEEEE-S CS
                        B3  79 fvvFkldgrsefelvvkvfrk 99 
                                v+F   ++ ++el+++v+r+
  Niben101Scf11552g00015.1 240 AVLFL--RTADGELRLGVRRA 258
                               *****..4589999****997 PP

2Auxin_resp111.67.7e-37283364182
                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                               +++a+s++++F+++YnPr s+s Fv +++k++k+l +++s+GmRfkm++eted++e+r++G+vvgvsd+dpvrWp+SkW++L
  Niben101Scf11552g00015.1 283 VVNAISSTNAFSICYNPRGSSSGFVLPYHKFSKTLAHPFSAGMRFKMRVETEDAAEKRFTGLVVGVSDVDPVRWPGSKWKCL 364
                               6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.3E-40151262IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-42151261IPR015300DNA-binding pseudobarrel domain
CDDcd100171.01E-21155257No hitNo description
PROSITE profilePS5086313.394157259IPR003340B3 DNA binding domain
SMARTSM010191.6E-22157259IPR003340B3 DNA binding domain
PfamPF023625.5E-22157258IPR003340B3 DNA binding domain
PfamPF065073.1E-31284364IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 737 aa     Download sequence    Send to blast
MMMCGLIDLN TVDNDDVGQE TTAPVSPASS STTSGCSDLT SSSLPAVASV CMELWHACAG  60
PMISLPKKGS AVVYLPQGHL EHLSEYPPIA YNLPPHVFCR VVDVKLQADA ASDEVYAQVS  120
LVPDNQIEQK WRDGDIYADT EEEEIEGAGK STTPHMFCKT LTASDTSTHG GFSVPRRAAE  180
DCFPPLDYRQ QRPSQELVAK DLHGIEWKFR HIYRGQPRRH LLTTGWSAFV NKKKLVSGDA  240
VLFLRTADGE LRLGVRRASQ AKTCSNYLAA YSQLLNVSGI VDVVNAISST NAFSICYNPR  300
GSSSGFVLPY HKFSKTLAHP FSAGMRFKMR VETEDAAEKR FTGLVVGVSD VDPVRWPGSK  360
WKCLLIRWDD LDVSRHNRVS PWEIEPSGSA PLSSSLVMPS AKRTRIGFPI TKADFPIPRD  420
GIAVSDFGES SRFQKVLQGQ EILGINSPYG GFDAHSPRTG GTRCFPIFPS SGTSRMGSSI  480
RTLLGDSDKS PKSIGFSDSS RFNKVLQGQE TFSTPPYGRG HAGSLMQEKS RTGIIIGIQV  540
PSHVNRWSAP NQSHCNPSTL VPAPSPPSVL SFQHPRSPAS KFQAMFNHQH GKLETATQAL  600
DMSESCSRHL ASGSHAEDIS RKGDTQGISS FSFLKEQKQT GISYLSLGTQ SSQNLVSMCK  660
TSCRIFGFPL TENKLNATRA ENPAEAVYSR DLETTFLPSS DGKLQPGQPL MSNVVGTNFT  720
KVNDLYAARD VLLDIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1074938918357Auxin response factor 1
4ldy_B1e-1074938918357Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589968.10.0PREDICTED: auxin response factor 3
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLM1D4H80.0M1D4H8_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000812820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61012333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein